PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10002949m
Common NameCARUB_v10002949mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 334aa    MW: 37271.4 Da    PI: 8.52
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10002949mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.8e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l d+++++G+g +W + + + g++R++k+c++rw++yl
  Carubv10002949m 14 RGPWSPEEDSKLRDYIEKYGNGgNWISLPLKAGLRRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding414.5e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +++  G++ W+ Ia++++ gRt++++k++w++
  Carubv10002949m  69 GDFSEEEDMIIFSLFAAIGSR-WSIIAAHLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.911962IPR017930Myb domain
SuperFamilySSF466892.37E-2712109IPR009057Homeodomain-like
SMARTSM007171.2E-111364IPR001005SANT/Myb domain
PfamPF002494.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-231569IPR009057Homeodomain-like
CDDcd001674.28E-91662No hitNo description
PROSITE profilePS5129422.17563117IPR017930Myb domain
SMARTSM007174.5E-1367115IPR001005SANT/Myb domain
PfamPF002494.7E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2370117IPR009057Homeodomain-like
CDDcd001678.86E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGRAPCCDKT KVKRGPWSPE EDSKLRDYIE KYGNGGNWIS LPLKAGLRRC GKSCRLRWLN  60
YLRPNIKHGD FSEEEDMIIF SLFAAIGSRW SIIAAHLPGR TDNDIKNYWN TKLRKKLLSS  120
SSSSSSSHSS SAMASPYLNP NSQDVKRSLT PSVTIPSSSY NPYAENPNQD PTKYLISNIN  180
GFEADDKQIF PYSNLNYPQD LSLSDSNNNI SGASGFLLNH NMCDHYNNHT SFSSDVNGKR  240
SETMIKQEEM MMMMMIDHHI DQRTKGYNGD STQGYYNYYN GHGDLKQMIS GTGTNSNINM  300
GGSGSSSSSI SNLAENKSSS SLLQHKCLPY FYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1755070.0AK175507.1 Arabidopsis thaliana mRNA for myb like transcription factor (MYB37), complete cds, clone: RAFL21-93-G12.
GenBankAY5196280.0AY519628.1 Arabidopsis thaliana MYB transcription factor (At5g23000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286724.10.0hypothetical protein CARUB_v10002949mg
SwissprotQ9FG680.0RAX1_ARATH; Transcription factor RAX1
TrEMBLR0FC290.0R0FC29_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0006_21710.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140131623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23000.11e-161myb domain protein 37